PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000268364
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 470aa    MW: 51546.2 Da    PI: 9.1467
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000268364genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.46e-33194250360
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh+k
  MDP0000268364 194 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSL-DGQIAEIVYKGEHNHSK 250
                    9***************************************.***************85 PP

2WRKY1047.9e-33394450359
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    Dg++WrKYGqK+vkg+++prsYYrCts +C+v+k+ver ++dpk++++tYeg+Hnh+
  MDP0000268364 394 DGFRWRKYGQKVVKGNPYPRSYYRCTSLKCNVRKHVERVSDDPKAFITTYEGKHNHD 450
                    9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-30179251IPR003657WRKY domain
SuperFamilySSF1182904.05E-26189251IPR003657WRKY domain
SMARTSM007743.8E-37192250IPR003657WRKY domain
PfamPF031061.5E-25194248IPR003657WRKY domain
PROSITE profilePS5081123.686194251IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.7E-35378452IPR003657WRKY domain
SuperFamilySSF1182907.98E-29385452IPR003657WRKY domain
PROSITE profilePS5081134.968387452IPR003657WRKY domain
SMARTSM007741.2E-37392451IPR003657WRKY domain
PfamPF031068.3E-26394450IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MDIKEAERVX IAKPVASRPT CSTFRSFTEL LAGAIDASPS NVSSETAVPA IRPKTVRFKP  60
LVNHAVDGLV SSQVDISGAA HRHSSGKVSK PDSRSTVVYK PLAKVVSRAT VSVLANMGNF  120
NTCHQSTRSS VNADVLRPNQ DKSFRSQSVI LRHNNPSCAE TNQTTEPPKI ASQNMEEDPK  180
IVPSTANTDR PSYDGYNWRK YGQKQVKGSE YPRSYYKCTH PNCPVKKKVE RSLDGQIAEI  240
VYKGEHNHSK PQPPKRXSSG TQGLGVASDG TGQDTNNRLC NSHHNERNXG SEVRLEDQNE  300
VGLPVHFYQS KALLPYDPLA SGGINGGGAT PDNSCGLSGE CEEGSKGLEA EDCEPRSKRR  360
KSENQSNEAG ISGEGVQDPR VVVQSSVESD MTGDGFRWRK YGQKVVKGNP YPRSYYRCTS  420
LKCNVRKHVE RVSDDPKAFI TTYEGKHNHD MPLRNANTGA SEKDTXKEKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-32194452877Probable WRKY transcription factor 4
1wj2_A1e-32194452877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.116540.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0201090.0KJ020109.1 Malus hybrid cultivar TTG2 protein (TTG2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008387690.10.0PREDICTED: WRKY transcription factor 44
TrEMBLM5VZ010.0M5VZ01_PRUPE; Uncharacterized protein
STRINGVIT_08s0040g03070.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67903450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.11e-115WRKY family protein